Tesamorelin and Ipamorelin (Blend) (8mg)
This Tesamorelin/Ipamorelin blend combines Tesamorelin, a growth hormone-releasing hormone (GHRH) analogue, with Ipamorelin, a selective growth hormone secretagogue, to facilitate controlled studies of growth hormone pathways. The complementary mechanisms of these peptides may work together to potentially enhance body composition, support tissue repair, and improve metabolic parameters.
$115.00
- Fast Shipping
- Secure Checkout
- For Research Use Only
Tesamorelin and Ipamorelin Blend Product Description
The Tesamorelin/Ipamorelin blend combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models.
This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg).Tesamorelin and Ipamorelin Peptide Structure
Tesamorelin
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Formula: C223H370N72O69S Molecular Weight: 5196 g/mol PubChem CID: 44147413 CAS Number: 901758-09-6 Synonyms:- Tesamorelin acetate
- 901758-09-6
- TH9507
- UNII-LGW5H38VE3
- Tesamorelin acetate [USAN]
Ipamorelin
Sequence: Aib-His-D-2Nal-D-Phe-Lys Molecular Formula: C38H49N9O5 Molecular Weight: 711.9 g/mol PubChem CID: 9831659 CAS Number: 170851-70-4 Synonyms:- 170851-70-4
- Ipamorelin [INN]
- NNC-26-0161
- UNII-Y9M3S784Z6
Lyophilized Peptides:
These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.Disclaimer: For Research Purposes Only
99%+ Purity Guarantee
Research-grade peptides with verified potency. Each product includes certificates of analysis.
GMP Manufacturing Standards
Synthesized in USA-registered facilities following Good Manufacturing Practices. Full chain of custody documentation.
Best In Class Fulfillment
Same-day shipping on orders before 12 PM PT. Free standard domestic shipping on orders over $400.
Zero Fillers or Additives
Pure active compounds only. Independently verified composition for reliable in vitro studies.




