“MOTS-c (10mg)” has been added to your cart. View cart
FOXO4-DRI (10 mg)
FOXO4-DRI is a synthetic peptide designed to selectively induce apoptosis in senescent cells, which are cells that have stopped dividing but remain metabolically active. These cells contribute to aging and various age-related diseases through their pro-inflammatory secretions, known as the senescence-associated secretory phenotype (SASP).
$274.97
Add to cart
Buy Now
Categories Peptide Vials, Peptides
Brand: NutriGenix
- Fast Shipping
- Secure Checkout
- For Research Use Only
FOXO4-DRI Peptide Description
FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids) |
| Molecular Formula | C228H388N86O64 |
| Molecular Weight | 5358 g/mol |
| CAS Number | 2460055-10-9 |
| Synonyms | Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431 |
FOXO4-D-Retro-Inverso Structure
Source: Uniprot
Product Usage:
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.Disclaimer: For Research Purposes Only
This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use in humans. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.
99%+ Purity Guarantee
Research-grade peptides with verified potency. Each product includes certificates of analysis.
GMP Manufacturing Standards
Synthesized in USA-registered facilities following Good Manufacturing Practices. Full chain of custody documentation.
Best In Class Fulfillment
Same-day shipping on orders before 12 PM PT. Free standard domestic shipping on orders over $400.
Zero Fillers or Additives
Pure active compounds only. Independently verified composition for reliable in vitro studies.
Related products
Select options
This product has multiple variants. The options may be chosen on the product page
Follistatin (FLGR242) (10mg)
$2,397.00 – $28,764.00Price range: $2,397.00 through $28,764.00
Select options
This product has multiple variants. The options may be chosen on the product page



